DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and Tmeff1

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_075409.1 Gene:Tmeff1 / 63845 RGDID:62005 Length:373 Species:Rattus norvegicus


Alignment Length:218 Identity:56/218 - (25%)
Similarity:83/218 - (38%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 GTDGRTYN-TECQLRK---RACRTNNAQLEVAYRGHCKNSCSGVHCLNGLTCVEDQYLMPHCIAC 632
            |..|::.| :|..||:   |||..::.:    |.|.||....|:.|                 ||
  Rat    49 GGRGKSINCSELNLRESDIRACDESSCK----YGGVCKEDGDGLKC-----------------AC 92

  Fly   633 RIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPCRAGRVSCA-- 695
            :.:|..:.:           .|||.:|.||::.|.:.|..||..:.|.|...|||.:...|.:  
  Rat    93 QFQCHTNYI-----------PVCGSNGDTYQNECFLRRAACKHQKDITVVARGPCYSDNGSGSGE 146

  Fly   696 -------------DIKCGP---KDNCLVDLQTRQPRCVTCRYKCPRKQQRPVHKICGYNNQTYNS 744
                         ..||||   |..|  |.......|| |...|......||   |..:..:||:
  Rat   147 GEEEGSGAGAHRKHSKCGPCKYKAEC--DEDAENVGCV-CNIDCSGYSFNPV---CASDGSSYNN 205

  Fly   745 WCEMHKHSCESRYFIGVKSQGSC 767
            .|.:.:.||..:..|.::..|.|
  Rat   206 PCFVREASCIRQEQIDIRHLGHC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 11/35 (31%)
KAZAL_FS 654..687 CDD:238052 13/32 (41%)
KAZAL_FS 723..767 CDD:238052 11/43 (26%)
Tmeff1NP_075409.1 KAZAL 92..136 CDD:197624 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 1/21 (5%)
KAZAL 182..228 CDD:197624 13/49 (27%)
PHA02887 <268..304 CDD:165214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.