DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and tmeff1a

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:XP_698980.5 Gene:tmeff1a / 570409 ZFINID:ZDB-GENE-070912-294 Length:336 Species:Danio rerio


Alignment Length:211 Identity:61/211 - (28%)
Similarity:85/211 - (40%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 PQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHCKNSCSGVHCLNGLTCVEDQYLMP- 627
            |:..:||||:||.||::||.||:.||. ..:.:.:...|||.::.|.    :|.|.:|...|.| 
Zfish    86 PRMFDPVCGSDGDTYHSECFLRQAACE-QQSPITIITEGHCPDAESA----SGDTDLESSGLEPS 145

  Fly   628 ---HCIACRI--ECP------WDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAV 681
               .|.:||.  ||.      |...::|..||: ...|||.||::|.:.|.:....|.....|.|
Zfish   146 SYSRCSSCRFGAECDEDSEGIWCVCNIDCGGYN-LNPVCGSDGQSYSNPCQVREASCLKQAQINV 209

  Fly   682 AYPGPCRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRYKCPR-KQQRPVHKICGYNNQTYNSW 745
            .:.|.|....|.......|              |.:    .||. .....||..|...|......
Zfish   210 RHLGQCSGSAVLVGGANVG--------------RAM----PCPEINSSSCVHGTCEMKNDLATCR 256

  Fly   746 CEM---HKHSCESRYF 758
            |.:   .|| ||.|.|
Zfish   257 CNLGFSGKH-CELRDF 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 16/39 (41%)
KAZAL_FS 654..687 CDD:238052 11/32 (34%)
KAZAL_FS 723..767 CDD:238052 13/40 (33%)
tmeff1aXP_698980.5 KAZAL 81..125 CDD:197624 16/39 (41%)
KAZAL 169..215 CDD:197624 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.