Sequence 1: | NP_652376.2 | Gene: | Fs / 2768836 | FlyBaseID: | FBgn0259878 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_698980.5 | Gene: | tmeff1a / 570409 | ZFINID: | ZDB-GENE-070912-294 | Length: | 336 | Species: | Danio rerio |
Alignment Length: | 211 | Identity: | 61/211 - (28%) |
---|---|---|---|
Similarity: | 85/211 - (40%) | Gaps: | 41/211 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 564 PQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHCKNSCSGVHCLNGLTCVEDQYLMP- 627
Fly 628 ---HCIACRI--ECP------WDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAV 681
Fly 682 AYPGPCRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRYKCPR-KQQRPVHKICGYNNQTYNSW 745
Fly 746 CEM---HKHSCESRYF 758 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fs | NP_652376.2 | KAZAL | 564..604 | CDD:197624 | 16/39 (41%) |
KAZAL_FS | 654..687 | CDD:238052 | 11/32 (34%) | ||
KAZAL_FS | 723..767 | CDD:238052 | 13/40 (33%) | ||
tmeff1a | XP_698980.5 | KAZAL | 81..125 | CDD:197624 | 16/39 (41%) |
KAZAL | 169..215 | CDD:197624 | 14/46 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |