DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and spink2.1

DIOPT Version :10

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001185680.1 Gene:spink2.1 / 565497 ZFINID:ZDB-GENE-070112-972 Length:77 Species:Danio rerio


Alignment Length:32 Identity:15/32 - (46%)
Similarity:19/32 - (59%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 PLPPQHSNPVCGTDGRTYNTECQLRKRACRTN 592
            |:..:..:|||||||.||:.||.|......||
Zfish    35 PICQRDYSPVCGTDGLTYSNECMLCMEIFETN 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 14/29 (48%)
KAZAL_FS 654..687 CDD:238052
KAZAL_FS 723..767 CDD:238052
spink2.1NP_001185680.1 Kazal_1 29..77 CDD:395004 15/32 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.