Sequence 1: | NP_652376.2 | Gene: | Fs / 2768836 | FlyBaseID: | FBgn0259878 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062764.1 | Gene: | Tmeff2 / 56363 | MGIID: | 1861735 | Length: | 374 | Species: | Mus musculus |
Alignment Length: | 226 | Identity: | 57/226 - (25%) |
---|---|---|---|
Similarity: | 82/226 - (36%) | Gaps: | 68/226 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC-----KNSCSGVH---------------- 612
Fly 613 CLNGLTCVEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGR 677
Fly 678 SIAVAYPGPCRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRY----KCPRKQQRPVHKICGYN 738
Fly 739 NQTYNSWCEMH---KHS---------CESRY 757 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fs | NP_652376.2 | KAZAL | 564..604 | CDD:197624 | 14/34 (41%) |
KAZAL_FS | 654..687 | CDD:238052 | 12/32 (38%) | ||
KAZAL_FS | 723..767 | CDD:238052 | 12/47 (26%) | ||
Tmeff2 | NP_062764.1 | KAZAL_FS | 95..135 | CDD:238052 | 14/34 (41%) |
KAZAL | 181..227 | CDD:197624 | 16/56 (29%) | ||
PHA02887 | <236..301 | CDD:165214 | 13/64 (20%) | ||
Required for shedding. /evidence=ECO:0000250 | 303..320 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 353..374 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |