DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and tmeff1b

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001020472.1 Gene:tmeff1b / 553511 ZFINID:ZDB-GENE-050706-143 Length:364 Species:Danio rerio


Alignment Length:219 Identity:58/219 - (26%)
Similarity:83/219 - (37%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC-KNSCSG--------------------VH 612
            |||||:|.||..||.|::.||....: :.:|..|.| .:|.||                    .:
Zfish   100 PVCGTNGDTYQNECYLKQAACNQQKS-IVLANEGPCDPDSSSGSGNGEFDGSGLESGKKVTKCSN 163

  Fly   613 CLNGLTCVEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGR 677
            |..|..|.||......| :|:|:|         ||::| ..|||.||.:|.:.|.:....|....
Zfish   164 CKYGAECDEDAEDEDSC-SCKIDC---------SGHNE-NPVCGTDGNSYHNPCLVREASCMKQE 217

  Fly   678 SIAVAYPGPCRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRYKCPRKQQR-----PVHKICGY 737
            .|.|.:.|            :|..||.   ..:|.........|..|.|:.:     ||.....|
Zfish   218 QIDVKHLG------------RCPDKDK---SKKTEAGLPYKPDYADPAKEGKGYGWLPVPCTDDY 267

  Fly   738 NNQTYNSWCEMH----KHSCESRY 757
            .|...:..||::    ...|:|.|
Zfish   268 ANFCVHGQCELNFGIATCRCDSGY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 15/34 (44%)
KAZAL_FS 654..687 CDD:238052 11/32 (34%)
KAZAL_FS 723..767 CDD:238052 11/44 (25%)
tmeff1bNP_001020472.1 KAZAL 89..134 CDD:197624 15/34 (44%)
KAZAL 182..227 CDD:197624 17/66 (26%)
PHA02887 <263..300 CDD:165214 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.