Sequence 1: | NP_652376.2 | Gene: | Fs / 2768836 | FlyBaseID: | FBgn0259878 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057887.2 | Gene: | Reck / 53614 | MGIID: | 1855698 | Length: | 971 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 53/215 - (24%) |
---|---|---|---|
Similarity: | 75/215 - (34%) | Gaps: | 75/215 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC--KNSCSGVHCLNGLTCVEDQYLMPHCIA 631
Fly 632 C----------RIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGP 686
Fly 687 CRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRYKCPRKQQRPVHKICGYNNQTYNSWCEMHKH 751
Fly 752 SCESRYF-----IGVKSQGS 766 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fs | NP_652376.2 | KAZAL | 564..604 | CDD:197624 | 12/34 (35%) |
KAZAL_FS | 654..687 | CDD:238052 | 7/32 (22%) | ||
KAZAL_FS | 723..767 | CDD:238052 | 13/49 (27%) | ||
Reck | NP_057887.2 | 5 X Knot repeats | 37..338 | ||
Amnionless | <802..>867 | CDD:291494 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |