powered by:
Protein Alignment Fs and Spink7
DIOPT Version :9
Sequence 1: | NP_652376.2 |
Gene: | Fs / 2768836 |
FlyBaseID: | FBgn0259878 |
Length: | 767 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002816.2 |
Gene: | Spink7 / 408237 |
RGDID: | 1303077 |
Length: | 86 |
Species: | Rattus norvegicus |
Alignment Length: | 53 |
Identity: | 18/53 - (33%) |
Similarity: | 27/53 - (50%) |
Gaps: | 7/53 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 558 IYAPLP------PQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC 604
||...| |..:.||||:|..||..:|:|.....| :|.:::..:.|||
Rat 35 IYKKYPVVAIPCPIENIPVCGSDYITYGNKCKLCTEILR-SNGKIQFLHEGHC 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.