DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and CG1077

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_649617.1 Gene:CG1077 / 40751 FlyBaseID:FBgn0037405 Length:730 Species:Drosophila melanogaster


Alignment Length:211 Identity:52/211 - (24%)
Similarity:80/211 - (37%) Gaps:66/211 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 PVCGTDGRT-----YNTECQLRKRACRTNNAQLEVAYRGHCKNSCSGVHCLNG-LTCVEDQYLMP 627
            |.|......     :..||.|||            |.||         :.:|| |..|..::..|
  Fly    37 PACAQSRENGMYFLFANECDLRK------------AQRG---------NLMNGPLYDVTLRFCFP 80

  Fly   628 HCIACRIECPWDNLDVDSSGYDERQAVCGV-----DGKTYRSACDINRMICKIGRSIAVAYP-GP 686
               :|..||        ||.|   |.|||:     :.||:||.|::.|..| |.||..:.:. |.
  Fly    81 ---SCEFEC--------SSRY---QPVCGISSKSGERKTFRSRCEMLRTAC-ISRSEWMVHRWGV 130

  Fly   687 CRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRYKCPRKQQRPVHKICGYNNQTYNSWCEMHKH 751
            |             ||.|.:..:..:.|..|.|     .:..|||..:......|:::.|.::..
  Fly   131 C-------------PKANAVPQISEKPPVPVPC-----TRIYRPVCAMYAGVKSTFSNECLVNAE 177

  Fly   752 SCESRYFIGVKSQGSC 767
            :.:|:....:.|:|.|
  Fly   178 NIKSQRNWRIVSEGLC 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 10/39 (26%)
KAZAL_FS 654..687 CDD:238052 14/38 (37%)
KAZAL_FS 723..767 CDD:238052 8/43 (19%)
CG1077NP_649617.1 KAZAL_FS 86..131 CDD:238052 19/56 (34%)
KAZAL_FS 149..193 CDD:294071 9/48 (19%)
KAZAL 335..383 CDD:197624
Podoplanin <612..688 CDD:283467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10913
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.