DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and agr-1

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001022152.3 Gene:agr-1 / 3565243 WormBaseID:WBGene00018304 Length:1473 Species:Caenorhabditis elegans


Alignment Length:203 Identity:67/203 - (33%)
Similarity:97/203 - (47%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 SNPVCGTDGRTYNTECQLRKRAC--RTNNAQLEVAYRGHCKNSCSGVHCLNGLTCVEDQYLMPHC 629
            |:|||.:.|..|.:.|.||..||  :||   :.|.:.|.| :.|.|..|.||.||.......|.|
 Worm   265 SSPVCSSHGVDYQSSCHLRHHACESKTN---ITVKFFGRC-DPCHGHKCPNGQTCQLGVDRRPEC 325

  Fly   630 IACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPCRAGRVSC 694
             .|..:|..::..           |||.|||||.:.|.:....||..:.|.|...|.|......|
 Worm   326 -KCSEQCTMNSAH-----------VCGTDGKTYLNECFLKLAACKEQKDILVWKRGNCDEAGSPC 378

  Fly   695 ADIKCGPKDNCLVDLQTRQPRCVTCRYKCPRKQQRPVHKICGYNNQTYNSWCEMHKHSCESRYFI 759
            ..::||...:|:|    :..|...|  :||.:.:..:..:|..|.:|:::.|||.|.|||::..|
 Worm   379 EKMECGFWGSCVV----KPDRTAEC--ECPNRCEDVMRPVCATNGETFDNECEMKKKSCETKSMI 437

  Fly   760 GVKSQGSC 767
            .||.||:|
 Worm   438 KVKHQGTC 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 15/38 (39%)
KAZAL_FS 654..687 CDD:238052 14/32 (44%)
KAZAL_FS 723..767 CDD:238052 17/43 (40%)
agr-1NP_001022152.3 KAZAL 172..220 CDD:197624
KAZAL 251..301 CDD:197624 15/38 (39%)
KAZAL 327..371 CDD:197624 16/54 (30%)
KAZAL 400..445 CDD:197624 17/44 (39%)
KAZAL 472..516 CDD:197624
KAZAL 547..592 CDD:197624
KAZAL 612..660 CDD:197624
EGF_Lam 670..716 CDD:238012
EGF_Lam 722..>759 CDD:238012
KAZAL <819..852 CDD:197624
LamG 1081..1236 CDD:238058
LamG 1289..1450 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6413
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.