Sequence 1: | NP_652376.2 | Gene: | Fs / 2768836 | FlyBaseID: | FBgn0259878 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022152.3 | Gene: | agr-1 / 3565243 | WormBaseID: | WBGene00018304 | Length: | 1473 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 67/203 - (33%) |
---|---|---|---|
Similarity: | 97/203 - (47%) | Gaps: | 24/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 567 SNPVCGTDGRTYNTECQLRKRAC--RTNNAQLEVAYRGHCKNSCSGVHCLNGLTCVEDQYLMPHC 629
Fly 630 IACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPCRAGRVSC 694
Fly 695 ADIKCGPKDNCLVDLQTRQPRCVTCRYKCPRKQQRPVHKICGYNNQTYNSWCEMHKHSCESRYFI 759
Fly 760 GVKSQGSC 767 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fs | NP_652376.2 | KAZAL | 564..604 | CDD:197624 | 15/38 (39%) |
KAZAL_FS | 654..687 | CDD:238052 | 14/32 (44%) | ||
KAZAL_FS | 723..767 | CDD:238052 | 17/43 (40%) | ||
agr-1 | NP_001022152.3 | KAZAL | 172..220 | CDD:197624 | |
KAZAL | 251..301 | CDD:197624 | 15/38 (39%) | ||
KAZAL | 327..371 | CDD:197624 | 16/54 (30%) | ||
KAZAL | 400..445 | CDD:197624 | 17/44 (39%) | ||
KAZAL | 472..516 | CDD:197624 | |||
KAZAL | 547..592 | CDD:197624 | |||
KAZAL | 612..660 | CDD:197624 | |||
EGF_Lam | 670..716 | CDD:238012 | |||
EGF_Lam | 722..>759 | CDD:238012 | |||
KAZAL | <819..852 | CDD:197624 | |||
LamG | 1081..1236 | CDD:238058 | |||
LamG | 1289..1450 | CDD:238058 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6413 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.760 |