Sequence 1: | NP_652376.2 | Gene: | Fs / 2768836 | FlyBaseID: | FBgn0259878 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572845.1 | Gene: | CG12716 / 32248 | FlyBaseID: | FBgn0030439 | Length: | 418 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 40/203 - (19%) |
---|---|---|---|
Similarity: | 63/203 - (31%) | Gaps: | 75/203 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 534 LQHGSETAASSDLANTH-------------------------DLAHLGGIYAPLPPQHSN----- 568
Fly 569 -----PVC---GTDGRTYNTECQLRKRACR---TNNAQLEVAYRGHCKNSCSGVHCLNGLTCVED 622
Fly 623 QYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPC 687
Fly 688 ----RAGR 691 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fs | NP_652376.2 | KAZAL | 564..604 | CDD:197624 | 11/55 (20%) |
KAZAL_FS | 654..687 | CDD:238052 | 5/32 (16%) | ||
KAZAL_FS | 723..767 | CDD:238052 | |||
CG12716 | NP_572845.1 | KAZAL_FS | 146..192 | CDD:238052 | 12/73 (16%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10913 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |