DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and CG12716

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster


Alignment Length:203 Identity:40/203 - (19%)
Similarity:63/203 - (31%) Gaps:75/203 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 LQHGSETAASSDLANTH-------------------------DLAHLGGIYAPLPPQHSN----- 568
            |..|.....||.:||.|                         |..|.|  ..|:..|:.:     
  Fly    28 LGRGVLAQKSSPIANWHMADPHYTSDQYAKILGEAGLGQDADDKEHKG--LGPMQIQYVDYQPNC 90

  Fly   569 -----PVC---GTDGRTYNTECQLRKRACR---TNNAQLEVAYRGHCKNSCSGVHCLNGLTCVED 622
                 |||   |||...:...|:|.....:   .:..:||......|..:|..:.|    |.|| 
  Fly    91 QPGGVPVCATNGTDSFYFENHCRLEAANMKMLFQHGTELEPTEMERCLPNCQTMKC----TQVE- 150

  Fly   623 QYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPGPC 687
               .|.|....|.                    |...:|:.:.|::.:..|...:.:.:.:.|||
  Fly   151 ---RPVCALAEIG--------------------GAIPQTFANECEMRKHECHTKQVLRILHTGPC 192

  Fly   688 ----RAGR 691
                ::||
  Fly   193 QTPTKSGR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 11/55 (20%)
KAZAL_FS 654..687 CDD:238052 5/32 (16%)
KAZAL_FS 723..767 CDD:238052
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 12/73 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10913
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.