DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and TMEFF2

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_057276.2 Gene:TMEFF2 / 23671 HGNCID:11867 Length:374 Species:Homo sapiens


Alignment Length:226 Identity:57/226 - (25%)
Similarity:82/226 - (36%) Gaps:68/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC-----KNSCSGVH---------------- 612
            ||||::|.:|..||.||:.||: ..:::.|...|.|     ..|..|||                
Human   101 PVCGSNGESYQNECYLRQAACK-QQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDI 164

  Fly   613 CLNGLTCVEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGR 677
            |..|..|.||...: .|: |.|:|...|.:          .:|..|||:|.:||.|....|:...
Human   165 CQFGAECDEDAEDV-WCV-CNIDCSQTNFN----------PLCASDGKSYDNACQIKEASCQKQE 217

  Fly   678 SIAVAYPGPCRAGRVSCADIKCGPKDNCLVDLQTRQPRCVTCRY----KCPRKQQRPVHKICGYN 738
            .|.|...|.|              :||.....::.........|    ....:..|..|..|   
Human   218 KIEVMSLGRC--------------QDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPC--- 265

  Fly   739 NQTYNSWCEMH---KHS---------CESRY 757
            .:.||.:| ||   :||         |::.|
Human   266 PEHYNGFC-MHGKCEHSINMQEPSCRCDAGY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 14/34 (41%)
KAZAL_FS 654..687 CDD:238052 12/32 (38%)
KAZAL_FS 723..767 CDD:238052 12/47 (26%)
TMEFF2NP_057276.2 KAZAL_FS 95..135 CDD:238052 14/34 (41%)
KAZAL 181..227 CDD:197624 16/56 (29%)
PHA02887 <236..301 CDD:165214 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.