powered by:
Protein Alignment Fs and Spink4
DIOPT Version :9
Sequence 1: | NP_652376.2 |
Gene: | Fs / 2768836 |
FlyBaseID: | FBgn0259878 |
Length: | 767 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_035593.2 |
Gene: | Spink4 / 20731 |
MGIID: | 1341848 |
Length: | 86 |
Species: | Mus musculus |
Alignment Length: | 47 |
Identity: | 19/47 - (40%) |
Similarity: | 24/47 - (51%) |
Gaps: | 3/47 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 560 APLP--PQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC 604
|.|| ||..|.:|||||.||..||.|.....:|.. .:::...|.|
Mouse 41 AELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMK-DIQIMKDGQC 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.