DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and FSTL3

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_005851.1 Gene:FSTL3 / 10272 HGNCID:3973 Length:263 Species:Homo sapiens


Alignment Length:486 Identity:90/486 - (18%)
Similarity:120/486 - (24%) Gaps:282/486 - (58%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 AAAGTCWQTHLGSGKCGQVFSTDISRSECCGSS------QSFSYTDRELSSVEYFFATAIGGGVE 267
            |..|.||........|..|..||::|:|||.|.      .:.::...:::.:.:.      |.|.
Human    33 APGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFL------GLVH 91

  Fly   268 CSPCMESCKGFKCGPNKKCVKRKGRPKCVCAPECGAALRRRTHQQELELEQEPELEEEQQEMKPP 332
            |.||.:||.|.:|||.|.|....|||:|.|||:|                               
Human    92 CLPCKDSCDGVECGPGKACRMLGGRPRCECAPDC------------------------------- 125

  Fly   333 RESRSLSSENTNFNLGLDGGQRQRADNQRKLQPRESKHRRLLIIDSSSRSSSNLPDQPTSGRRGR 397
                                                               |.||          
Human   126 ---------------------------------------------------SGLP---------- 129

  Fly   398 VEMTGYERRRHRNNHGKHLTRSMTTGANDSFPADKTPAQSPAADSILAQSRLANLANANEPANDI 462
                                                                             
Human   130 ----------------------------------------------------------------- 129

  Fly   463 NRQSSTRVRHQHARRIEHAPNPDNGLRKRQHKQQQQHQHQHQDRMNTEAQSANTTVSGSGSGATN 527
                                                                             
Human   130 ----------------------------------------------------------------- 129

  Fly   528 HRRISQLQHGSETAASSDLANTHDLAHLGGIYAPLPPQHSNPVCGTDGRTYNTECQLRKRACRTN 592
                ::||                                  |||:||.||..||:||...|| .
Human   130 ----ARLQ----------------------------------VCGSDGATYRDECELRAARCR-G 155

  Fly   593 NAQLEVAYRGHCKNSCSGVHCLNGLTCVEDQYLMPHCIACR-IECPWDNLDVDSSGYDERQAVCG 656
            :..|.|.|||.|:.||..|.|....:||.||....||:.|| ..||     |.||   ..|.:||
Human   156 HPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCP-----VPSS---PGQELCG 212

  Fly   657 VDGKTYRSACDINRMICKIGRSIAVAYPGPC 687
            .:..||.|:|.:.:..|.:||||.|.:.|.|
Human   213 NNNVTYISSCHMRQATCFLGRSIGVRHAGSC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 18/39 (46%)
KAZAL_FS 654..687 CDD:238052 13/32 (41%)
KAZAL_FS 723..767 CDD:238052
FSTL3NP_005851.1 KAZAL 120..167 CDD:197624 27/307 (9%)
KAZAL_FS 171..>231 CDD:294071 24/67 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..263 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12130
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1460520at2759
OrthoFinder 1 1.000 - - FOG0003390
OrthoInspector 1 1.000 - - otm42275
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.