powered by:
Protein Alignment Fs and Spink9
DIOPT Version :9
Sequence 1: | NP_652376.2 |
Gene: | Fs / 2768836 |
FlyBaseID: | FBgn0259878 |
Length: | 767 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003749244.2 |
Gene: | Spink9 / 100911241 |
RGDID: | 1596746 |
Length: | 87 |
Species: | Rattus norvegicus |
Alignment Length: | 41 |
Identity: | 15/41 - (36%) |
Similarity: | 22/41 - (53%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 564 PQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC 604
|:...|||||||:||...|:..:.|...:..:|...:.|.|
Rat 47 PKIHKPVCGTDGKTYQNRCEFCQTAMERSVGKLGFKHEGKC 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.