DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and sparcl2

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:XP_017207307.1 Gene:sparcl2 / 100534809 ZFINID:ZDB-GENE-131127-575 Length:259 Species:Danio rerio


Alignment Length:169 Identity:39/169 - (23%)
Similarity:57/169 - (33%) Gaps:55/169 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 EDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPG 685
            |:..|.|.|: |...||           .:|..||.|.||||.:.|.:::..|:..|.|..|:.|
Zfish    66 EEGVLTPKCV-CPSTCP-----------RQRAPVCSVLGKTYSNECLLHKEACRKERRIGKAHNG 118

  Fly   686 PCRAGRVSCADIKCG------------------------PKDNCLVD---LQTRQPRCVTCRY-- 721
            .|......|::.:.|                        |..:||..   :|..|.|.|....  
Zfish   119 ACLVSETGCSEEEFGQFPYRLLDWFLLLSRMGERYTPAAPSQSCLSHTQRMQLAQRRFVLLDRNR 183

  Fly   722 --KCPRKQQRPVHKICGYNNQTYNSWCEMHKHSCESRYF 758
              |..|:..|.:|            :..|....|..|:|
Zfish   184 DGKLSRRDLRKLH------------YKRMPLEHCAQRFF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624
KAZAL_FS 654..687 CDD:238052 13/32 (41%)
KAZAL_FS 723..767 CDD:238052 7/36 (19%)
sparcl2XP_017207307.1 KAZAL 75..120 CDD:197624 17/56 (30%)
SPARC_EC 127..232 CDD:238155 17/96 (18%)
SPARC_Ca_bdg 127..226 CDD:287550 17/96 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4004
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.