DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and tmeff1

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001093738.2 Gene:tmeff1 / 100101772 XenbaseID:XB-GENE-876375 Length:372 Species:Xenopus tropicalis


Alignment Length:232 Identity:60/232 - (25%)
Similarity:85/232 - (36%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   555 LGGIYAPLPPQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHCKNSCSGVHCLNGLTC 619
            |.|:.|      |||:        .:||...|.....|.::|.:. ....:..|....|..|..|
 Frog    31 LPGVRA------SNPL--------PSECHNGKGKAGINCSELSLR-ESEVRRVCDESTCKYGGVC 80

  Fly   620 VEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYP 684
            .|:..:: .|| |:.:|        .:.|   ..|||.:|.||::.|.:.|..||..:.|.|...
 Frog    81 KEEGDVL-KCI-CQFQC--------QTNY---APVCGSNGDTYQNECFLRRSACKQQKEITVVAR 132

  Fly   685 GPC---------------RAGRVSCADIKCGPKDNCL----VDLQTRQPRCVTCRYKCPRKQQRP 730
            |||               ..|.|.....|||   ||.    .|.......|| |...|......|
 Frog   133 GPCFSDIASGSGEGEYEGSGGEVHKKHSKCG---NCKFGAECDEDAEDVGCV-CNIDCSGHNFNP 193

  Fly   731 VHKICGYNNQTYNSWCEMHKHSCESRYFIGVKSQGSC 767
            |   |..:..:|::.|.:.:.||..:..|.||...||
 Frog   194 V---CATDGSSYSNPCLVREASCLRQEQIDVKHLRSC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 8/39 (21%)
KAZAL_FS 654..687 CDD:238052 13/32 (41%)
KAZAL_FS 723..767 CDD:238052 11/43 (26%)
tmeff1NP_001093738.2 KAZAL 90..135 CDD:197624 17/56 (30%)
KAZAL 181..227 CDD:197624 13/49 (27%)
PHA02887 <267..303 CDD:165214
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.