DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fs and tmeff2a

DIOPT Version :9

Sequence 1:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001121837.1 Gene:tmeff2a / 100004613 ZFINID:ZDB-GENE-070912-622 Length:379 Species:Danio rerio


Alignment Length:219 Identity:53/219 - (24%)
Similarity:79/219 - (36%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 PVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC---KNSCSGVHCLNGLTCVEDQYLMPHCI 630
            ||||::...|..||.||:.||: ...::.|...|.|   ..|.||....|..:....|.....|.
Zfish   105 PVCGSNNENYENECFLRRDACK-QQTEILVVSEGSCPADAGSGSGDEAGNEGSAENGQKETSTCD 168

  Fly   631 ACRI--ECPWD--------NLDVDSSGYDERQAVCGVDGKTYRSACDINRMICKIGRSIAVAYPG 685
            .|:.  ||..|        |:|.....::   .||..||::|.:.|.:....|:....|.|.:.|
Zfish   169 ICQFGAECDVDAEDVWCVCNIDCSHISFN---PVCASDGRSYDNPCQVKEASCQRQERIEVKFLG 230

  Fly   686 PCRAGRVSCADIKCGPKDNCLVDLQTRQPRC--------VTC--RYK--CPRKQQRPVHKICGYN 738
            .|:...::  ..|.|.......|....:|..        :.|  .||  |       ||..|.|.
Zfish   231 HCQGDMIT--GTKAGDGQYARTDYTEEKPEVSEVARGLYIPCPEHYKNYC-------VHGDCEYP 286

  Fly   739 NQTYNSWCEMHK----HSCESRYF 758
            |......|..|.    ..|:::.:
Zfish   287 NMLSTPSCSCHSGFSGPQCDTKEY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FsNP_652376.2 KAZAL 564..604 CDD:197624 13/34 (38%)
KAZAL_FS 654..687 CDD:238052 10/32 (31%)
KAZAL_FS 723..767 CDD:238052 9/40 (23%)
tmeff2aNP_001121837.1 KAZAL_FS 99..139 CDD:238052 13/34 (38%)
KAZAL 186..232 CDD:197624 12/48 (25%)
PHA02887 <266..306 CDD:165214 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.