DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG14518

DIOPT Version :9

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:155 Identity:39/155 - (25%)
Similarity:80/155 - (51%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLSICFIGHMTD-----SQLVYKFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYPL 65
            ::|.|..:.|...     ..:::|.|...|:. |::.|:...|.::.::.|...:|:|..|::|:
  Fly     3 IVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPV 67

  Fly    66 INPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQL 129
            .:..::.::..:  :|.|||:|...:|..|..:.|:|.....: |||||:.::.:. :|...|..
  Fly    68 HDVIVKARLLKR--ANGYKPWLYSVSFDGCQFIRRRNNALIRI-VWELFKEYSTINHTCPYVGLQ 129

  Fly   130 SARNGYLNSSYVP-PFPHGQYQISV 153
            ..:|.||.|..:| |.|.|:|.:.:
  Fly   130 QVKNFYLRSEKLPTPIPTGEYLLMI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 25/82 (30%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.