DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG13590

DIOPT Version :9

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:175 Identity:42/175 - (24%)
Similarity:78/175 - (44%) Gaps:10/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGHMTDSQLVY-KFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYPLINPTIRVQVFM 76
            :.:::..:..| |.|...|:. |::.|....|.:|..:.....:|::...:.|..|.::..:...
  Fly    14 VAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVEPARNISVHFKTMK 78

  Fly    77 KDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSARNGYLNSSY 140
            |  :|.|||||.|.||..|:.:.|:| .|.|.::|.:.:..:.:. :|...| |...:.:.....
  Fly    79 K--ANGYKPFLFDYTFDACEFMRRRN-QPVAKIIWYMIRNVSTINHTCPYEG-LQMLSDFHKVDI 139

  Fly   141 VPPFPHGQYQISVMFSDSNSTNREFVGIVKF-FVQAMDEIKIKKR 184
            ..|.|.|.|.:.|.:.....|  :|...|.| |::.:.....|.|
  Fly   140 PVPLPSGDYLLMVDWLFDGKT--QFATNVYFTFIEDLLPTSSKHR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 23/81 (28%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.