DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG13561

DIOPT Version :9

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:151 Identity:38/151 - (25%)
Similarity:67/151 - (44%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HMTDSQLVYKFTKVECQGNQARVKNVS-CNVKPINWNTALVNLDCYLI-YPLINPTIRVQVFMKD 78
            |:...|.|.|||.:||.........|| |.:..:..:...::|...:: :|....::|:|:..| 
  Fly    15 HILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKK- 78

  Fly    79 YSNQYKPFLID-ATFKLCDVVERKNFLPYAVMVWELFQRFTNVKSCHISGQLSARNGYLNSSYVP 142
             ::.|||||.: ....:|:.:|::|. |:..::...|...|||..|.|..::     .|.....|
  Fly    79 -ASGYKPFLYNICQSDVCEYLEKRNH-PFINIILSSFGNRTNVNKCPIPPEI-----VLEHFRFP 136

  Fly   143 -------PFPHGQYQISVMFS 156
                   |.|.|.|.:...|:
  Fly   137 VKVLDMMPLPFGDYGLFTTFT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 24/88 (27%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.