DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG33923

DIOPT Version :9

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:169 Identity:40/169 - (23%)
Similarity:67/169 - (39%) Gaps:45/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLLSICFIGHMTDSQLVYKFTKVECQGNQARVKNVS----------CNVKPINWNTALVNLDCY 60
            ||.|||          .:|.|.:..|:...|.:|.|:          |.:|.::.....::|...
  Fly     7 LVQLSI----------FLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVK 61

  Fly    61 LIYPLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SC- 123
            |:...|. .|::.|.:....|.|||||.:.|...|...:.:...|.|..::..|:.::|:. || 
  Fly    62 LLETPIT-KIKINVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125

  Fly   124 -------------HISGQLSARNGYLNSSYVPPFPHGQY 149
                         |::.|::.         |.|.|||.|
  Fly   126 YDHDIIVEKLPISHVNTQVTK---------VLPVPHGDY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 24/95 (25%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.