DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG33771

DIOPT Version :9

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:192 Identity:43/192 - (22%)
Similarity:70/192 - (36%) Gaps:62/192 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLLSICFIGHMTDSQLVYKFTKVECQGNQARVK-NVSCNVK-------PINWNTALVNLDCYL 61
            |.:|.....:      |||:| |::....:|..|. |.|.|.|       .|..||  :|:|.:|
  Fly     2 WKLLTLFLLV------QLVFK-TEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNT--MNMDMHL 57

  Fly    62 IYPLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVKSCHIS 126
            ..|       :|...|.:        :|...:|.:.   |||       ..:|.:.::|  |.::
  Fly    58 NRP-------IQRGFKAH--------VDILLRLANA---KNF-------QSMFSQKSDV--CAVT 95

  Fly   127 GQLSARNGYL-----------NSSYVPPFPHGQYQISVMFSDSNSTNR-----EFVGIVKFF 172
            .  |.:|...           |..|..|...|.|.:......|:.|::     |:.|.:.||
  Fly    96 S--SVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYMHDWRMGSSMTHKFLIPGEYRGKLTFF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 17/91 (19%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.