DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG33796

DIOPT Version :10

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:159 Identity:40/159 - (25%)
Similarity:82/159 - (51%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPYTWLVLLS---ICFIGHMTDSQLVYKFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYL 61
            |.|...:::|   :|.:.....:.:|:|.|.|.|.. |:..::...|.:|.||.:..:.|.:...
  Fly     1 MKYVLKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATF 65

  Fly    62 IYPLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHI 125
            :||..:.|:..|.|.::  |.|:|:|::.....|..: ||.:....::::.:::.|||:. :|.:
  Fly    66 LYPTKSITVHYQTFKRE--NGYRPWLVNTQIDGCRFL-RKPYDALGILLFNIYRNFTNINHTCPL 127

  Fly   126 SGQLSARNGYLNSSYVP-PFPHGQYQISV 153
            .|.:..||.||.:..:. |.|.|.|.:::
  Fly   128 QGDMIVRNMYLTTDVMRLPLPTGDYLLAI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 22/82 (27%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 22/82 (27%)

Return to query results.
Submit another query.