DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG33768

DIOPT Version :9

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:182 Identity:33/182 - (18%)
Similarity:74/182 - (40%) Gaps:32/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLSICFIGHMTDSQLVYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLDCYLIYPL---INPT 69
            :|.:.|:.....|.:.  ..:|:|:.|....  .:.||..:|   :.:..|..|:..|   ....
  Fly     7 VLMVIFVSQAVSSSVT--LNRVQCEKNAKFF--ATLNVTSVN---STIYADIELLQALKAGFRGH 64

  Fly    70 IRVQVFMKDYSNQYK-PFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTN--------VKSCHI 125
            :.||:.:   ||..| ..|:.|....|:::        :.:...||:|:..        :::|.:
  Fly    65 VDVQLRL---SNAKKFQSLVQADTDYCELL--------STLKDSLFRRWIKSVSKNSNFMENCPV 118

  Fly   126 -SGQLSARNGYLNSSYVPPF-PHGQYQISVMFSDSNSTNREFVGIVKFFVQA 175
             :|....:..::....||.: ..|.|.:|.:.......:::.:.:|:..|:|
  Fly   119 PAGHYYLKGWHVEMGLVPSYLLSGDYLLSALVYYGKYRSKKQMFLVRCMVEA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 17/91 (19%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 15/98 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.