DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33467 and CG33463

DIOPT Version :10

Sequence 1:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:191 Identity:46/191 - (24%)
Similarity:85/191 - (44%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTWLVLLSICFIGHMTDSQ--LVYKFTKVECQGNQARVKNVS-CNVKPINWNTALVNLDCYLI-Y 63
            ||.|.||...::.....|:  .:.:|..:.|:.......... |.:|.:|.....:::...|: .
  Fly     2 YTKLSLLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQL 66

  Fly    64 PLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SC---H 124
            |:.|..:...:|.:  .|.|||||.:.|...|.:|:...:.|.|...::.|:.|:|:. ||   |
  Fly    67 PVTNAKVNGALFQR--HNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNH 129

  Fly   125 --ISGQLSARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNREFVGIVKFFVQAMDEIKIKK 183
              |..:|:|::.|...:.:.|||.|.|.:.:.:..|        ||.:...:..  :.:||
  Fly   130 DIILDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTS--------GIYRVIFKVF--VSLKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 27/86 (31%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 27/86 (31%)

Return to query results.
Submit another query.