Sequence 1: | NP_995837.1 | Gene: | CG33468 / 2768833 | FlyBaseID: | FBgn0053468 | Length: | 172 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286422.1 | Gene: | CG33469 / 2768832 | FlyBaseID: | FBgn0053469 | Length: | 160 | Species: | Drosophila melanogaster |
Alignment Length: | 141 | Identity: | 51/141 - (36%) |
---|---|---|---|
Similarity: | 85/141 - (60%) | Gaps: | 0/141 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LEKRLERYLRSVFCLKEIDTKNEYIPTEVEYFGVLSLSDVRAPRRKLWYMYYATTDQVDKTVDQI 80
Fly 81 HRKYGQKNMYELFRKPVYTGAGMRSRVKNHFKGLKWHVKGNILEAPLGSSLNDEKVVNTIADLYQ 145
Fly 146 NERRRYFDYLM 156 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45468457 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0016611 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |