DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33468 and CG33469

DIOPT Version :9

Sequence 1:NP_995837.1 Gene:CG33468 / 2768833 FlyBaseID:FBgn0053468 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001286422.1 Gene:CG33469 / 2768832 FlyBaseID:FBgn0053469 Length:160 Species:Drosophila melanogaster


Alignment Length:141 Identity:51/141 - (36%)
Similarity:85/141 - (60%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LEKRLERYLRSVFCLKEIDTKNEYIPTEVEYFGVLSLSDVRAPRRKLWYMYYATTDQVDKTVDQI 80
            ::.:||:|.|.:|.:|.:..........:||||:.|:.:.....:|.||:||....:..|.:::|
  Fly     1 MDDKLEKYWRRLFYMKSVAEPTSLDADTIEYFGIFSIDEPNVAAQKRWYIYYGLRLERLKVLERI 65

  Fly    81 HRKYGQKNMYELFRKPVYTGAGMRSRVKNHFKGLKWHVKGNILEAPLGSSLNDEKVVNTIADLYQ 145
            .:|||.:|:.|:|:...::|.|....|:.:|..|||....|.|||||.|..|||::|.|::||:.
  Fly    66 RKKYGNRNVREIFQIATFSGVGFHKVVREYFSNLKWFTSRNQLEAPLNSYYNDERLVKTVSDLHN 130

  Fly   146 NERRRYFDYLM 156
            .|::|.|||:|
  Fly   131 KEQKRIFDYIM 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.