DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33228 and NOP4

DIOPT Version :10

Sequence 1:NP_995940.2 Gene:CG33228 / 2768732 FlyBaseID:FBgn0261373 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_015282.1 Gene:NOP4 / 856063 SGDID:S000005964 Length:685 Species:Saccharomyces cerevisiae


Alignment Length:31 Identity:10/31 - (32%)
Similarity:18/31 - (58%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 FVAKYPLRIYKSSEKYVAVYGSQLPIGTVKH 163
            ||...|   |.::|:.:|.:.|:  .|:||:
Yeast   293 FVRNVP---YDATEESLAPHFSK--FGSVKY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33228NP_995940.2 None
NOP4NP_015282.1 RRM1_Nop4p 26..104 CDD:410075
RRM2_Nop4p 147..229 CDD:410076
RRM3_Nop4p 289..387 CDD:410077 10/31 (32%)
RRM4_Nop4p 458..620 CDD:410078
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.