DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33228 and RBM28

DIOPT Version :9

Sequence 1:	NP_001286854.1	Gene:	CG33228 / 2768732	FlyBaseID:	FBgn0261373	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_060547.2	Gene:	RBM28 / 55131	HGNCID:	21863	Length:	759	Species:	Homo sapiens

Alignment Length:	100	Identity:	25/100 - (25%)
Similarity:	36/100 - (36%)	Gaps:	16/100 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    48 LFGDRLPDNYKLIYRAPIESYVTWTKNISTATTTVLAAVAAYHYATTINYLDMVQKMDIAILVSQ 112
            ||..|||.:.:......:.|.|...|.....|.....|...:.|.|    ..|::.:..|:
Human     6 LFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVT----FSMLEDVQRAL---- 62

  Fly   113 ESDLYYFVGGFLLINLAIRAFVAKYPLRIYKSSEK 147
             .::..|.|      ..|...|||..|| .|:.||
Human    63 -KEITTFEG------CKINVTVAKKKLR-NKTKEK 89

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33228	NP_001286854.1	None
RBM28	NP_060547.2	RRM1_RBM28_like	5..81	CDD:240859	20/89 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	84..105		2/5 (40%)
		RRM2_RBM28_like	115..190	CDD:240860
		RRM	126..721	CDD:330708
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..330
		RRM3_RBM28_like	335..417	CDD:240861
		RRM4_RBM28_like	487..581	CDD:240862
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	594..759
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0127
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900