DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33228 and rbm28

DIOPT Version :10

Sequence 1:NP_995940.2 Gene:CG33228 / 2768732 FlyBaseID:FBgn0261373 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956615.2 Gene:rbm28 / 393291 ZFINID:ZDB-GENE-040426-960 Length:856 Species:Danio rerio


Alignment Length:59 Identity:16/59 - (27%)
Similarity:20/59 - (33%) Gaps:16/59 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRPILAKPNFQLLHTSSVLRKWRNASSGEVERKLLFGDRLPDNYKLIYRAPIESYVTWT 72
            |:|...|..|..:....|         .|.|:.     |...|.|.|...|:|  |.||
Zfish   157 LKPDGKKKGFAFVQFKCV---------SEAEKA-----RAAMNRKAIRDRPVE--VDWT 199

Return to query results.
Submit another query.