DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33228 and Rbm28

DIOPT Version :9

Sequence 1:NP_001286854.1 Gene:CG33228 / 2768732 FlyBaseID:FBgn0261373 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_006236252.1 Gene:Rbm28 / 312182 RGDID:1311336 Length:753 Species:Rattus norvegicus


Alignment Length:127 Identity:27/127 - (21%)
Similarity:47/127 - (37%) Gaps:19/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LFGDRLPDNYKLIYRAPIESYVTWTKNISTATTTVLAAVAAYHYATTINYLDMVQKMDIAILVSQ 112
            ||..|||.:.:......:.|.|...|.....|.....|...:.|.|    ..|::.:..|:    
  Rat     6 LFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVT----FSMLEDVQRAL---- 62

  Fly   113 ESDLYYFVGGFLLINLAIRAFVAKYPLRIYKSSEKYVAVYGSQLPIGTVKHYFERGQIAEYK 174
             .::..|.|      ..|...:||..|:  ..|::......|:.|....||  ::.::|:.|
  Rat    63 -KEITTFEG------CKINVTIAKKKLK--NKSKETRKNENSESPKKEPKH--KKAKVADKK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33228NP_001286854.1 None
Rbm28XP_006236252.1 RRM1_RBM28_like 5..78 CDD:240859 17/86 (20%)
ELAV_HUD_SF 6..408 CDD:273741 27/127 (21%)
RRM2_RBM28_like 115..190 CDD:240860
PABP-1234 322..709 CDD:130689
RRM3_RBM28_like 329..411 CDD:240861
RRM4_RBM28_like 481..575 CDD:240862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0127
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.