DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33228 and rbm-28

DIOPT Version :10

Sequence 1:NP_995940.2 Gene:CG33228 / 2768732 FlyBaseID:FBgn0261373 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_497077.2 Gene:rbm-28 / 175145 WormBaseID:WBGene00011043 Length:608 Species:Caenorhabditis elegans


Alignment Length:90 Identity:15/90 - (16%)
Similarity:30/90 - (33%) Gaps:34/90 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ESYVTWTKNISTATTTV-------------LAAVAAY------------HYATTINYLDMVQKMD 105
            |..|.:.:|:|..|...             ||.:..|            |::|.|...:.::.::
 Worm   261 EGKVVFLRNLSYDTKEELIKEELSKFGKIDLAIICKYKDSGHSKGTAFVHFSTPIEASNCIEGVE 325

  Fly   106 IAILVSQESDLYYFVGGFLLINLAI 130
            ..:::...         .:..||||
 Worm   326 DGVIIDNR---------LVKANLAI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33228NP_995940.2 None
rbm-28NP_497077.2 RRM2_RBM28_like 96..173 CDD:409848
RRM3_RBM28_like 263..340 CDD:409849 11/85 (13%)
RRM4_RBM28_like 411..503 CDD:409850
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.