DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or46a and Or67b

DIOPT Version :9

Sequence 1:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:418 Identity:87/418 - (20%)
Similarity:164/418 - (39%) Gaps:92/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ADHQRRFQSMRFGFILVILFIMLLLFS---FEMLN-NISQVREILKVFFMFATEISCMAKLLHLK 87
            |..:|..:..|...|||::..:.:::|   |.|.| .||....:..|...|...:. :.|:.|.:
  Fly    35 APRKRSSKYCRLTRILVLIVNLSIIYSLVAFIMENYMISFETYVEAVLLTFQLSVG-VVKMFHFQ 98

  Fly    88 LKSRKLAGLVDAMLSPEFGVKSEQEMQMLELDRVAVVRMRNSYGIMSLGAASLILIVPCFDNF-- 150
            .|....:.||       |..::.:.::.|.|.::.:.|.:.     .|.:.||||:    :|:  
  Fly    99 NKVESCSQLV-------FSTETGEVLKSLGLFQLDLPRKKE-----LLSSVSLILL----NNWMI 147

  Fly   151 --GELPLAMLEVCSIEGWICY--WSQYLFHSICLL---PTCVLNITYDSV------------AY- 195
              .::......||....:.|.  :.||:|.  |.:   .||.:.:||.::            :| 
  Fly   148 IDRQVMFFFKIVCMPVLYYCVRPYFQYIFD--CYIKDKDTCEMTLTYPAIVPYLQLGNYEFPSYV 210

  Fly   196 ---------SLLCFLKV----QLQMLVLRLE-------------KLGPVIEPQDNEKIAMELREC 234
                     .|.||..|    .|.:::.|.|             ....::.|:|..  ...|:.|
  Fly   211 IRFFLLQSGPLWCFFAVFGFNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQR--VKYLQCC 273

  Fly   235 AAYYNRIVRFKDLVELFIKGPGSVQLMCSVLVLVSNLYDMSTMSIANGDAIFMLKTCIYQLVMLW 299
            ...:.||....:.:|...|....||...|.:::...||.:||  :.....::|....:|.:.:..
  Fly   274 VRLFARISSHHNQIENLFKYIILVQCSVSSILICMLLYKIST--VLEVGWVWMGMIMVYFVTIAL 336

  Fly   300 QIFIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRIVLLMMQRFNSPMLLSTFNPTFAFSLEA 364
            :|.:...::.:|..||..|.|..|:..|...:|..:.::.:|       :|.|  ..||..|:..
  Fly   337 EITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMM-------LLFS--RRTFVLSVGG 392

  Fly   365 FGS--------IVNCSYSYFALLKRVNS 384
            |.|        :...|.::|.||:.:|:
  Fly   393 FTSLSHKFLVQVFRLSANFFLLLRNMNN 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 70/366 (19%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 42/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.