DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or46a and Or49a

DIOPT Version :9

Sequence 1:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:442 Identity:81/442 - (18%)
Similarity:167/442 - (37%) Gaps:121/442 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EDFYKYQVWYFQILGVWQL-----PTWAADHQRRFQSMRFGFILVIL-------FIMLLLFSFEM 56
            |||.......|:.|| :.|     |.|      |:..:|..|:|..:       .:...:..:|.
  Fly     8 EDFIFMANMMFKTLG-YDLFHTPKPWW------RYLLVRGYFVLCTISNFYEASMVTTRIIEWES 65

  Fly    57 L-NNISQV-REILKVFFMFATEISCMAKLLHLKLKSRKLAGLVDAMLSPEFGVKSEQEMQMLELD 119
            | .:.|:: |:.|..|:|.::::    |.:...:..::|..|...:  .|.....||..:..|::
  Fly    66 LAGSPSKIMRQGLHFFYMLSSQL----KFITFMINRKRLLQLSHRL--KELYPHKEQNQRKYEVN 124

  Fly   120 RVAV-VRMRNSYGIMSLGAASLILIVPCFDNFGELPLAMLEVCSIEGWICYWSQYL-------FH 176
            :..: ...||            :|.|..|         ::.|.::|..:.....||       |.
  Fly   125 KYYLSCSTRN------------VLYVYYF---------VMVVMALEPLVQSCIMYLIGFGKADFT 168

  Fly   177 SICLLPTCVLNITYDS-------------VAYS-------------LLCF---LKVQLQMLVLRL 212
            ...:.||   .:|:||             ..||             ::|.   :.:.|..|...|
  Fly   169 YKRIFPT---RLTFDSEKPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANML 230

  Fly   213 EKL--GPVIEPQDNEKIAMELRECAAYYNRIVRF-KDLVELFIKGPGSVQLMCSVLVLVSNLYDM 274
            ..:  .|..|.||.:.:|..::.    :..::|. ||:..:|            .|:|.|||:..
  Fly   231 ASIRPSPETEQQDCDFLASIIKR----HQLMIRLQKDVNYVF------------GLLLASNLFTT 279

  Fly   275 STM-------SIANGDAIFMLKTCIYQLV---MLWQIFIICYASNEVTVQSSRLCHSIYSSQWTG 329
            |.:       ::..|   |..:...|.::   :..|.:::......:...|:.|..:.:.|:|..
  Fly   280 SCLLCCMAYYTVVEG---FNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYE 341

  Fly   330 WNRANRRIVLLMMQRFNSPMLLSTFNPTFAFSLEAFGSIVNCSYSYFALLKR 381
            .:...::.:|::|.:...|:.:|. ......||:.|..::..:|.:||::::
  Fly   342 GSLRYKKEILILMAQAQRPLEISA-RGVIIISLDTFKILMTITYRFFAVIRQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 62/361 (17%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 58/345 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.