DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or46a and Or43b

DIOPT Version :9

Sequence 1:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:197 Identity:46/197 - (23%)
Similarity:84/197 - (42%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 DSVAYSLLCFLKVQLQMLVLRLEKLG-PVIE-PQDNEKIAMELRECAAYYNRIVRFKDLVELFIK 253
            ||.....:..|:..:.:|..|:..|| |..| ..|...:...|.:|...:..::.|.|.::..|.
  Fly   205 DSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAIQPIIS 269

  Fly   254 GPGSVQ-LMC-SVL-VLVSNLYDMSTMSIANGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQS 315
            |....| ::| |:| :::.|:...:..|...|       ..||.:.:|.|.|.:|:..|.:....
  Fly   270 GTIFAQFIICGSILGIIMINMVLFADQSTRFG-------IVIYVMAVLLQTFPLCFYCNAIVDDC 327

  Fly   316 SRLCHSIYSSQWTGWNRANRRIVLLMMQRFNSPMLLSTFN------------PTFAFSLEAFGSI 368
            ..|.|:::.|.|...::..:|.|:..:|:...||..:..|            ..|||::.|..|.
  Fly   328 KELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAIASG 392

  Fly   369 VN 370
            :|
  Fly   393 MN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 46/197 (23%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 41/185 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.