DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or46a and Or35a

DIOPT Version :9

Sequence 1:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:398 Identity:85/398 - (21%)
Similarity:138/398 - (34%) Gaps:105/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VILFIMLLLFSFEMLNNISQVREI--------LKVFF----MFATEISCMAKLLHLKLKSRKLAG 95
            |:...|.|:|   |.:|.:::|.:        |..|.    .:...:....:.||:.|...||..
  Fly    46 VLAVAMSLVF---MQHNDAELRYLRFEASNRNLDAFLTGMPTYLILVEAQFRSLHILLHFEKLQK 107

  Fly    96 L---------VDAMLSPEFGVKSEQEMQMLELDRVAVVRMRNSYGIMSLGAASLILIVPCFD--- 148
            .         :|....||...|.:.:|.:..|       :...||    ...||.||.|.|.   
  Fly   108 FLEIFYANIYIDPRKEPEMFRKVDGKMIINRL-------VSAMYG----AVISLYLIAPVFSIIN 161

  Fly   149 -----------NFGELPLAMLEVCSIEGWICYWSQYLFHSICLLPTCVLNITYDSVAY---SLLC 199
                       .|...||                 |:|..: ||....:.|..|::.:   :|||
  Fly   162 QSKDFLYSMIFPFDSDPL-----------------YIFVPL-LLTNVWVGIVIDTMMFGETNLLC 208

  Fly   200 FLKVQLQ---MLV-----LRLEKL-----GPVIEPQDNEKIAMELRECAA--YYNRIVRFKDLVE 249
            .|.|.|.   ||:     |.:||:     .|.:..|....|...||:..|  .:.:.:..:..|.
  Fly   209 ELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVR 273

  Fly   250 LFIKGPGSVQLMCSVLVLVSNLYDMSTMSIANGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQ 314
            :||....:..|:|::      .:...|..:||............:|:.|.||      .:::...
  Fly   274 VFIMFAFAAGLLCAL------SFKAYTNPMANYIYAIWFGAKTVELLSLGQI------GSDLAFT 326

  Fly   315 SSRLCHSIYSSQW-------TGWNRANRRIVLLMMQ-RFNSPMLLSTFNPTFAFSLEAFGSIVNC 371
            :..|....|.:.|       |..:...|.:.|:.:. ..||.....|....|..||:|...|:..
  Fly   327 TDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQA 391

  Fly   372 SYSYFALL 379
            |:|||..|
  Fly   392 SFSYFTFL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 74/371 (20%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 73/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.