DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or46a and Or30a

DIOPT Version :9

Sequence 1:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:369 Identity:75/369 - (20%)
Similarity:140/369 - (37%) Gaps:95/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RRFQSMRFGFILVILFIMLLLFSFEMLNNISQVREILKVFFMFATEISCMAKLLHLKLKSRKLAG 95
            :||...||..||...:|.||.....::|.:  |:|        .|.:|.:...::|.:......|
  Fly    85 QRFSYERFINILKSFYIELLQSDDPIINIL--VKE--------TTRLSVLISRINLLMGCCTCIG 139

  Fly    96 LVDAMLSPEFGVKSEQEMQMLELDRVAVVRMRNSYGIMSLGAASLILIVPCFDNFGELPLAMLEV 160
            .|   ..|.||  ||:.:               .||          :.:|..|.:.         
  Fly   140 FV---TYPIFG--SERVL---------------PYG----------MYLPTIDEYK--------- 165

  Fly   161 CSIEGWICYWSQY-----LFHSICLLPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPVIE 220
                    |.|.|     :..:|.....|.:.|.|.::..:...|..:..::|..:|..|    |
  Fly   166 --------YASPYYEIFFVIQAIMAPMGCCMYIPYTNMVVTFTLFAILMCRVLQHKLRSL----E 218

  Fly   221 PQDNEKIAMELRECAAYYNRIVRFKD----------LVELFIKGPGSVQLMCSVL--VLVSNLYD 273
            ...||::..|:..|..|..::..|.|          |||....|    .::|.:|  ::::....
  Fly   219 KLKNEQVRGEIIWCIKYQLKLSGFVDSMNALNTHLHLVEFLCFG----AMLCVLLFSLIIAQTIA 279

  Fly   274 MSTMSIANGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRIV 338
            .:.:.||            |.:::.....::.|.:||:..||..:..:.|.|.|..::...::.:
  Fly   280 QTVIVIA------------YMVMIFANSVVLYYVANELYFQSFDIAIAAYESNWMDFDVDTQKTL 332

  Fly   339 LLMMQRFNSPMLLSTFNPTFAFSLEAFGSIVNCSYSYFALLKRV 382
            ..::.|...|:.: ....|:..:|:...|::|..||:|.||:||
  Fly   333 KFLIMRSQKPLAI-LVGGTYPMNLKMLQSLLNAIYSFFTLLRRV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 58/327 (18%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 68/358 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.