DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or46a and Or82a

DIOPT Version :9

Sequence 1:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:270 Identity:51/270 - (18%)
Similarity:98/270 - (36%) Gaps:71/270 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PLAMLEVCSIEGWIC-----YWSQYLF-------HSICLLPTCVLNI-------TYDSVAYSLLC 199
            |:..:.||...|..|     ...::.|       :.:|.|.|.::.:       ..|.:..|...
  Fly   145 PIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGYEVCFLYTVLVTVVVVAYASAVDGLFISFAI 209

  Fly   200 FLKVQLQMLVLRLEKLG-PVIEPQDNEKIAMELRECAAYYNRIVRFKDLVELFIKGPGSVQLMCS 263
            .|:...|.|..::|... |..||...                 :|.|.:||..:       |:.|
  Fly   210 NLRAHFQTLQRQIENWEFPSSEPDTQ-----------------IRLKSIVEYHV-------LLLS 250

  Fly   264 VLVLVSNLYDMSTMS----------------IANGDAI--FMLKTCIYQLVMLWQIFIICYASNE 310
            :...:.::|..:.|.                :.|.|::  .:|....:..:|| |:||.||....
  Fly   251 LSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGSIML-QLFIYCYGGEI 314

  Fly   311 VTVQSSRLCHSIYSSQW---TGWNRANRRIVLLMMQRFNSPMLLSTFNPTFAFSLEAFGSIVNCS 372
            :..:|.::..::..|.|   :...|.:..:::|..|:  ..::.:.|   |..||..|..|...:
  Fly   315 IKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQK--EVLIRAGF---FVASLANFVGICRTA 374

  Fly   373 YSYFALLKRV 382
            .|...|:|.:
  Fly   375 LSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 48/259 (19%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 48/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.