DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33476 and CG13250

DIOPT Version :10

Sequence 1:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:92 Identity:19/92 - (20%)
Similarity:40/92 - (43%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MYKVDNFDGCQFLMNPLMNRVFGTVYKRLVVNGSF-FSCPIKPGVYYIRNEGSV--AMLPVFQPP 133
            ::|: ..|||..:.....:|:...|..:|:.:|:: .:||:...|.|.....::  ...|.:.|.
  Fly    99 LFKI-RVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNYTSTRFALNPDHFPAYMPD 162

  Fly   134 GRYQITMRVRM-------RESRDPFVM 153
            .::...:..::       |.|.|..||
  Fly   163 MKFNTKLVFQLSRNMGLIRASVDAEVM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 14/68 (21%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 14/82 (17%)

Return to query results.
Submit another query.