DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33476 and CG13589

DIOPT Version :10

Sequence 1:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:127 Identity:28/127 - (22%)
Similarity:49/127 - (38%) Gaps:41/127 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSCDHN--FVE-----YFHKAPDMVDIYTFRVVKLA---KAFTIDFAVRVVKTKRVMYKVDNFDG 80
            ||.:.|  |:|     |.|          .:::|.|   |.|..|:               .||.
  Fly    55 TSLNINATFIEPAKNIYLH----------MKMMKKANGYKPFLFDY---------------TFDA 94

  Fly    81 CQFLMNPLMNRVFGTVYKRLVVNGSF--FSCPIKPGVYYIRNEGSVAMLPVFQPPGRYQITM 140
            |:|:..  .|:.|..:...::.|.|.  .:||.: |:..:.:...:. :||..|.|.|.:.:
  Fly    95 CEFMRR--RNQPFAKIVWNMIKNVSTVNHTCPYE-GLQMLSDFHHID-VPVPLPSGDYLLLL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 18/82 (22%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 19/89 (21%)

Return to query results.
Submit another query.