DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33476 and CG33783

DIOPT Version :10

Sequence 1:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:46 Identity:14/46 - (30%)
Similarity:19/46 - (41%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVDQCSRFRGGSKFIMESLATSCDHNFVEYFHKAPDMVDIYTFRVV 51
            :||.||.|:...::....|......||....|..|...||...|:|
  Fly    75 TVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33476NP_995798.2 DUF1091 57..138 CDD:461928
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.