powered by:
Protein Alignment CG33477 and LOC5667829
DIOPT Version :10
| Sequence 1: | NP_995797.1 |
Gene: | CG33477 / 2768726 |
FlyBaseID: | FBgn0053477 |
Length: | 198 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_061516003.1 |
Gene: | LOC5667829 / 5667829 |
VectorBaseID: | AGAMI1_004264 |
Length: | 73 |
Species: | Anopheles gambiae |
| Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
| Similarity: | 20/48 - (41%) |
Gaps: | 22/48 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 141 KCPIKPNVYYLKTDGIMSMIPSVHPFGRFQLSMRVKMKESRKP-FVME 187
:|||.|.:| |:| .|.:|.::.| |::|
Mosquito 17 RCPIAPGLY-------------VYP--------NVSLKRTQIPSFLLE 43
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33477 | NP_995797.1 |
DUF1091 |
100..171 |
CDD:461928 |
7/29 (24%) |
| LOC5667829 | XP_061516003.1 |
None |
Return to query results.
Submit another query.
