DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG14518

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:116 Identity:26/116 - (22%)
Similarity:54/116 - (46%) Gaps:25/116 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FVEY----FHRVPDSKILYTFRVVKLAPAFTINITIKVLKTHR----IMYKIENFKGCEFL---N 118
            :||:    ...|..:|:........|.|...:.:..::||...    .:|.: :|.||:|:   |
  Fly    39 WVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSV-SFDGCQFIRRRN 102

  Fly   119 NP---VIFKMFGESYKTLVVNGSYFKCPI----KPNVYYLKTDGIMSMIPS 162
            |.   :::::|.| |.|  :|.:   ||.    :...:||:::.:.:.||:
  Fly   103 NALIRIVWELFKE-YST--INHT---CPYVGLQQVKNFYLRSEKLPTPIPT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 19/77 (25%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 18/72 (25%)

Return to query results.
Submit another query.