DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG14456

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:82 Identity:19/82 - (23%)
Similarity:35/82 - (42%) Gaps:22/82 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 HRIMYKIENFKGCEFLNN------------PVI-FKMFGESY-------KTLVVNGSYFKCPIKP 146
            |||..| ...:|..|:|.            |.: |::..::.       :||::|..:....:..
  Fly   133 HRIHLK-RKLQGSYFINKFWWPEDPTTAMLPELEFEIIWQAMHVDASKKRTLIMNDHFGGDFVVQ 196

  Fly   147 NVYYLKTDGIMSMIPSV 163
            :|..|| .||.:|:|.:
  Fly   197 DVNNLK-PGIFAMLPKI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 19/82 (23%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 12/56 (21%)

Return to query results.
Submit another query.