DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG14455

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:139 Identity:30/139 - (21%)
Similarity:59/139 - (42%) Gaps:47/139 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TFRVVKLAPAFTIN---ITIKV--------------LKTHR--------IMYKIENFKG------ 113
            :|:|:..:..|..|   :.:||              :|||:        :.:.:|..||      
  Fly    28 SFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVDFGLETDKGNYSTLI 92

  Fly   114 ------CEFL----NNPVIFKMFGESYKTLVVNGSYFK-CPIKPNVYYLKTDGI-MSMIPSVHPF 166
                  |:.:    ::|::..:    |:.|:.:|:.|| |||:...|.|....: ..|:||..|.
  Fly    93 NRTLNFCKLMKQRNSDPLVRAI----YEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPSFLPE 153

  Fly   167 GRFQLSMRV 175
            .:|:..|::
  Fly   154 AKFRFGMKI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 23/96 (24%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 18/80 (23%)

Return to query results.
Submit another query.