DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG12849

DIOPT Version :9

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:182 Identity:34/182 - (18%)
Similarity:66/182 - (36%) Gaps:54/182 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVNRGHIFYLCLFGLLFFVEEHEVISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRCDHDF 65
            ||: |||.               |..:|:||...:.....:...::..|..|...||.|:     
  Fly    15 MAI-RGHF---------------EFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTK----- 58

  Fly    66 VEYFHRVPDSKILYTFRVVKLAPAFTINITIKVLKTHRIMYKIENFK--GCEFLNNPV------I 122
               ..|:|.......|:             :::.:..|::|..: ||  .|:|:.:..      :
  Fly    59 ---MFRLPVDNCETRFQ-------------LRMRENRRVLYNFD-FKVDSCKFMRDRKHVIANWV 106

  Fly   123 FKMFGESYKTLVVNGSYFKCPIKPNVYY--LKTDGIMSMIPSVHPFGRFQLS 172
            ::.|| .|..|     ...||...::..  |....:..::.|:.|.||:.::
  Fly   107 YQTFG-PYSNL-----NHTCPYDHDIVLDKLPVQHLNKLVQSIIPDGRYMMN 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 17/80 (21%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.