DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG33923

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:145 Identity:24/145 - (16%)
Similarity:47/145 - (32%) Gaps:63/145 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FVEYFHRVPDSKILYTFRVVKLAPAFT----------------INITIKVLKTH--------RIM 105
            |:..||:..........:.|.|.|.|.                :::.:|:|:|.        .|:
  Fly    13 FLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAIL 77

  Fly   106 YKIENFK---------GCEFL----NNPVIFKMFGESYKTLVVNGSYFK--------CPIKPNVY 149
            .::..:|         .|:|.    :||:...::           |:||        ||...:: 
  Fly    78 QRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLY-----------SFFKDYSNINHSCPYDHDI- 130

  Fly   150 YLKTDGIMSMIPSVH 164
                  |:..:|..|
  Fly   131 ------IVEKLPISH 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 15/94 (16%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 14/86 (16%)

Return to query results.
Submit another query.