DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG33648

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:118 Identity:24/118 - (20%)
Similarity:45/118 - (38%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LESLDTRC---DHDFVEYFHRVPDSKILYTFRVVKLAPAFTI----NITIKVLKTHR------IM 105
            :|..:.:|   |..:| |:.......:..|::.:.:.....|    |.||.|....|      .:
  Fly    23 VEFTNIKCSSSDTSYV-YYESCRIKSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPFL 86

  Fly   106 YKIENFKGCEFL----NNPVIFKMFGESYKTLVVNGSYFKCPIKPNVYYLKTD 154
            |.: :...|.||    :|.|:..:|     .|::..|..:.|..|...::..|
  Fly    87 YNV-SVDACRFLRTQKSNIVVKYLF-----DLILLKSNIRSPTCPFNSFISVD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 13/65 (20%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 15/69 (22%)

Return to query results.
Submit another query.