DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG33702

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:123 Identity:29/123 - (23%)
Similarity:45/123 - (36%) Gaps:29/123 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HDFVEYFHRVPDSKI---LYTFRVVKLAPAFTINITIKVLKTHRIMYKIENFKGCEFLNNP---V 121
            |..::|..  |.:||   |..||...:...|.:|.||..               |.::..|   .
  Fly    59 HIAIKYSQ--PINKIEFNLSIFRKSNMYRLFLVNHTIDF---------------CYYMRRPEQYP 106

  Fly   122 IFKMFGESYKTLVVNGSYFKCPIKPNVYYLK----TDGIMSMIPSVHPFGRFQLSMRV 175
            ||.||.:|  .:....:...||......|:|    .|..:..:.|..|.|.::|.:.|
  Fly   107 IFYMFHDS--LMAATNANHSCPYTEKDIYVKKMTFNDKTLKDLLSFLPVGEYKLVVSV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 15/77 (19%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:461928 22/101 (22%)

Return to query results.
Submit another query.