DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG14492

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:167 Identity:33/167 - (19%)
Similarity:63/167 - (37%) Gaps:56/167 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IPQPIAVQRGNAEYSLESLDTRCDHDFVEYFHRVPDSKILYTFRVVKLAPAFT-INITIKVLKTH 102
            :.||:|                 :|||.        .||:...|  :..|.|. :|:|.      
  Fly    73 LEQPVA-----------------EHDFF--------IKIVLPRR--RPLPDFVLLNVTT------ 104

  Fly   103 RIMYKIENFKGCEFL--NNPVIFKMFGESYKTLVVNGSYF--KCPIKPN-VYYLKTDGI-MSMIP 161
                     .||:.|  .|.|.....|   :.::...|.|  :||.||| .||::...: ::::|
  Fly   105 ---------DGCQLLANRNQVPLMRLG---RNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVP 157

  Fly   162 SVHPFGRFQLSMRVKMKESRKPFVMEMLLNYTIVRIK 198
            :|.    .:..::::.....|...:..:..|.:.|::
  Fly   158 AVD----METPVQIEFSHQNKQQGIRWITGYLMARVQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 17/76 (22%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 23/112 (21%)

Return to query results.
Submit another query.