powered by:
Protein Alignment CG33477 and CG13193
DIOPT Version :9
Sequence 1: | NP_995797.1 |
Gene: | CG33477 / 2768726 |
FlyBaseID: | FBgn0053477 |
Length: | 198 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610699.1 |
Gene: | CG13193 / 36256 |
FlyBaseID: | FBgn0033650 |
Length: | 189 |
Species: | Drosophila melanogaster |
Alignment Length: | 32 |
Identity: | 10/32 - (31%) |
Similarity: | 18/32 - (56%) |
Gaps: | 1/32 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 KCPIKPNVYYLKTDGIMS-MIPSVHPFGRFQL 171
:|||:|..|.::...:.: .||...|.|.::|
Fly 131 RCPIQPASYDVRNFQLENHSIPGYLPAGFYRL 162
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33477 | NP_995797.1 |
DUF1091 |
100..171 |
CDD:284008 |
9/30 (30%) |
CG13193 | NP_610699.1 |
DM8 |
91..183 |
CDD:214778 |
10/32 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.